Domain assignment for gi|56415437|ref|YP_152512.1| from Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
20 390 Nucleotide-diphospho-sugar transferases 1.13e-77 glucose-1-phosphate thymidylyltransferase 0.00000752 1yp2 A:10-316 Alignments
312 411 Trimeric LpxA-like enzymes 1.52e-18 GlmU C-terminal domain-like 0.032 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 431
Comment glucose-1-phosphate adenylyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
Sequence
MVSLEKNDRVMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSLFSEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIKEATAFGVMAVDESDKIIDFVEKPANPPAMPGDASKSLASMGIYVFDADYLYELLAADDKDDASSHDFGKDIIPKITREGMAYAHPFPLSCVQSDPQAEPYWRDVGTLEAYWKANLDLASVTPELDMYDQNWPIRTHMESLPPAKFVQDRSGSHGMTLNSLVSGGCIISGSVVVQSVLFPRVRINSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACIIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLQVKQER

Download

Sequence (FASTA)