Domain assignment for gi|360035619|ref|YP_004937382.1| from Vibrio cholerae O1 str. 2010EL-1786

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 357 Nucleotide-diphospho-sugar transferases 4.22e-68 glucose-1-phosphate thymidylyltransferase 0.0000102 1yp2 A:10-316 Alignments
293 401 Trimeric LpxA-like enzymes 2.5e-20 GlmU C-terminal domain-like 0.0061 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 405
Comment glucose-1-phosphate adenylyltransferase [Vibrio cholerae O1 str. 2010EL-1786]
Sequence
MAGVLGMILAGGEGSRLKPLTETRTKPAVPFGGSYRLIDFALNNFVNADLMRIYVLTQFKSQSLYIHMKKGWNLSGITDRFIDIIPAQMRDGKRWYEGTADAIYQNLRFVEIVAPDQVCIFGSDHIYKMDIRQMLDFHRRMEAELTVSALRMPISQASQFGVIEVDENGKMVGFEEKPSNPKSIPGEPEWALVSMGNYIFEAETLSKELREDAENNQSSHDFGKDIIPKMFPRGKVYVYDFTTNKIKGEKESTYWRDVGTIESYWSAHMDLLDKDPEFSLYNRSWPLHTYYPPLPPATFVDVKDKKVKITDSLISGGSYIQGSTIYKSVLGFRSNIAAGSFISESVILGDVKIGAGCTIKRAIIDKDVEIAAGTIIGEDLEMDRKRFHVSDEGIVVIAKGSKVGF

Download

Sequence (FASTA)