Domain assignment for gi|383789018|ref|YP_005473587.1| from Caldisericum exile AZM16c01

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 151 Ribosomal protein S5 domain 2-like 2.48e-33 GHMP Kinase, N-terminal domain 0.00036 1oj4 A:1-163 Alignments
155 275 GHMP Kinase, C-terminal domain 0.0000000000000201 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.026 1oj4 A:164-283 Alignments

Protein Sequence Details

Sequence length 282
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Caldisericum exile AZM16c01]
Sequence
MTMEAKAYAKLNLTLEITGELGEYHTIESVFQKISLFDVVSVKLGKSDSIIFSESIRNITSTVHKALELFKKKANVKENFEIYVKKNIPMGSGLGGGSADGAITLLLLNAMFKNILSKSDLYEIAKEVGSDVPFFLDSNTAWVKGIGDIVQELPNLKELYFVLVHPKFHFKTKEMYAMFHDYGKYSDGTRTLTLVELIKKGNYTAKDIDKLCYNDFEMMLLEKSEKFVEFKNILETIAEVKFHLTGSGSTVFAIFDTKKEAEKVKNTLDKMKFNTDLVSSNI

Download

Sequence (FASTA)