Domain assignment for gi|67459637|ref|YP_247261.1| from Rickettsia felis URRWXCal2

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 187 NAD(P)-binding Rossmann-fold domains 3.73e-47 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00018 1mv8 A:1-202 Alignments
304 428 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.15e-34 UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0019 1mv8 A:301-436 Alignments
198 291 6-phosphogluconate dehydrogenase C-terminal domain-like 9.01e-30 UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0033 1dlj A:197-294 Alignments

Protein Sequence Details

Sequence length 448
Comment UDP-glucose 6-dehydrogenase [Rickettsia felis URRWXCal2]
Sequence
MNITFIGSGYVGLVSGIIMGYLGHNVTCLDNDEVKISKLNKQILPIYEAKLDEYLKQALEANRLKFTNIYNNELQNAEAIFITVGTPSKESGEADLKYVYDAIDKVSEHINKDCLIVIKSTVPPDSCSNIIAYLKSKGFSFNVASNPEFLREGSAVEDFLYPDRIVVGVNNKESEEILRKIYAPLIEQGAKFVVTDLVTSELIKYASNSFLATKIAFINEMADLCEKIGGNIEDLSKGVGLDQRIGQNFLNAGPGFGGSCFPKDILALNNLVENHHIDCKILKAVIKSNKQRPSNMVDKIATLLDGDLKGKNIAVLGLTYKAGTDDVRASPAIEIVKILLNKDVYVKAFDPIGLENAKKNLEHKNLLYLDSVAEACKSVDIIVIATEWLEFKELNWQGIYDLVKFPIVIDLRNIIDNEAMKKIGFRYYAVGSKLDVIPAKAGIHYKAR

Download

Sequence (FASTA)