Domain assignment for gi|507526247|ref|YP_008047870.1| from Burkholderia sp. RPE64

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 387 Nucleotide-diphospho-sugar transferases 2.05e-77 glucose-1-phosphate thymidylyltransferase 0.00000987 1yp2 A:10-316 Alignments
326 397 Trimeric LpxA-like enzymes 0.0000000000033 GlmU C-terminal domain-like 0.035 1hv9 A:252-452 Alignments

Protein Sequence Details

Sequence length 422
Comment glucose-1-phosphate adenylyltransferase [Burkholderia sp. RPE64]
Sequence
METLAKNRTDLQKSTLAIVLAGGRGTRLGPLTDKRVKPAVHFGGKYRIVDFALSNCLNSGIRRIAVVTQYKAHSLIRHLQRGWGFLRGEFNEFIDIWPAQQRVDSSWYRGTADAVYQNLDIVRSIGPEFVIVLAGDHIYKMDYTRMVLDHVESGADCTVGCIEVPRMDAVAFGVMHVDENRRVTAFLEKPADPPAMPGKPDIALASMGIYVFSAKYLYEMLQDNIENSSTDHDFGKDIIPRVVTTGKAIAHPFGMSCVTSSSDPDAPAYWRDVGTVDAYWAANLDLASTIPELDLYDRNWPIWTNQEQLPPGKFVRDLNGQQGAITNLLVCGGCVISGSQVSKSVFSSAVRVHSFCNINEAVLLPQVTIGPSCRLQRVVIDRGCTVPEGLVVGEDPDDDAARFFRTESGVTLITREALARLS

Download

Sequence (FASTA)