Domain assignment for gi|428771948|ref|YP_007163736.1| from Cyanobacterium stanieri PCC 7202

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 319 Nucleotide-diphospho-sugar transferases 4.93e-80 glucose-1-phosphate thymidylyltransferase 0.0000000149 1yp2 A:10-316 Alignments
292 429 Trimeric LpxA-like enzymes 3.74e-25 GlmU C-terminal domain-like 0.0000162 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 429
Comment glucose-1-phosphate adenylyltransferase [Cyanobacterium stanieri PCC 7202]
Sequence
MNKVLGIILGGGAGTRLYPLTKLRAKPAVPLAGKYRLIDIPISNCINSEILKIYVLTQFNSASLNRHVSRAYNFSGFSDGFVEVLAAQQTKENPDWFQGTADAVRQYIWLFDEWDIDEYIILSGDHLYRMDYSKFVEHHRKTNADITISVVPIDEKRAEAFGLMKIDDSGRITDFSEKPKGDALRQMAVDTSILGLSPEQAQEKPYIASMGIYVFKKEVLRKLLTENPDQTDFGKEIIPYAAKDHNIQAYLFKGYWEDIGTIEAFYDANLSLTNQPQPSFSFYDEKAPIYTRSRYLPPTKLLDSQVTQSIIGEGCIIKECRINHCVLGVRTRIETNCVVEDTLIMGADLYEPYTVRQAKLKEGGVPIGIGANSIVRRAIVDKNARIGQNVQIINKDRVEEANREDEGFLIRNGIVVVIKNASIADNTII

Download

Sequence (FASTA)