Domain assignment for gi|76789226|ref|YP_328312.1| from Chlamydia trachomatis A/HAR-13

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
22 402 Nucleotide-diphospho-sugar transferases 7.51e-67 glucose-1-phosphate thymidylyltransferase 0.00000599 1yp2 A:10-316 Alignments
318 440 Trimeric LpxA-like enzymes 5.65e-17 GlmU C-terminal domain-like 0.00082 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 441
Comment glucose-1-phosphate adenylyltransferase [Chlamydia trachomatis A/HAR-13]
Sequence
MAGRRTKEEQINRKRSHFYRDNVGVIVLCGGEGKRLSPLTCWRCKPTVSFGGRYKLIDVPISHAFASGFSKIFVIGQYLTYTLQQHLFKTYFYHGVMQDQIHLLVPERRDGSQVWYQGTADAIRQNLLYLQDSRVEYFLILSGDQLYNMDFRSIVDYAIDAQADMVIASQPVSDKDVSRFGVLKVDDESKLIDFYEKPQSEEILKHFRLSNTAMKKFGLDPQHGNFLGSMGIYLFRKDCLFQLLLEETGDDFGKELIHRQMHRGKTVAYLYDGYWTDIGTIESYYEANMALTQRPSHNIRGFNCYDDGGIIYSKNNHLPGAIISDSRISSSLLCEGAMIESGQVSNSVVGVRGVIGQGSVFDRSIMMGSDSYGSESFPLGIGKNCEIHKTIIDENCCIGNGVRLQNLQGHKDYDSPDGKLVVRDGIIIVPRGTQIPDNYVF

Download

Sequence (FASTA)