Domain assignment for gi|472331448|ref|YP_007663724.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 340 Nucleotide-diphospho-sugar transferases 9.65e-85 glucose-1-phosphate thymidylyltransferase 0.0000385 1yp2 A:10-316 Alignments
288 361 Trimeric LpxA-like enzymes 0.00000000000000848 gamma-carbonic anhydrase-like 0.055 1xhd A: Alignments

Protein Sequence Details

Sequence length 380
Comment glucose-1-phosphate adenylyltransferase [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI

Download

Sequence (FASTA)