Domain assignment for gi|472331448|ref|YP_007663724.1| from Bacillus subtilis subsp. subtilis str. BAB-1

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	2	340	Nucleotide-diphospho-sugar transferases	9.65e-85	glucose-1-phosphate thymidylyltransferase	0.0000385	1yp2 A:10-316	Alignments
	288	361	Trimeric LpxA-like enzymes	0.00000000000000848	gamma-carbonic anhydrase-like	0.055	1xhd A:	Alignments

Protein Sequence Details

Sequence length	380
Comment	glucose-1-phosphate adenylyltransferase [Bacillus subtilis subsp. subtilis str. BAB-1]
Sequence	MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI

Download

Sequence (FASTA)

---