Domain assignment for POPTR_0010s24440.1|PACid:18240752 from Populus trichocarpa v156

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
199 414 GHMP Kinase, C-terminal domain 5.32e-57 Mevalonate 5-diphosphate decarboxylase 0.0000594 1fi4 A:191-393 Alignments
8 194 Ribosomal protein S5 domain 2-like 1.75e-43 GHMP Kinase, N-terminal domain 0.00000168 1fi4 A:3-190 Alignments

Protein Sequence Details

Sequence length 416
Comment
Sequence
MAGKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNGKEISLSGGRYQNCLREIRAQACDAEDEEKGIKITKKDWEKLHVHVASYNNFPTAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKAEDGSDSLAVQLVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKRIKQMEEAIKNRDFGSFAQLTCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNRSEETPQVAYTFDAGPNAVLIAHNRKAATQLLQKLLFYFPPSSDADLNSYVIGDKSILKDAGIEDMKDVEALSPPPEIKNAQRSKGDVSYFICTKPGRGPVLLSDESQALLHPETGLPK

Download

Sequence (FASTA)