Domain assignment for POPTR_0008s02200.1|PACid:18247460 from Populus trichocarpa v156

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
199 414 GHMP Kinase, C-terminal domain 1.44e-55 Mevalonate 5-diphosphate decarboxylase 0.0000583 1fi4 A:191-393 Alignments
8 194 Ribosomal protein S5 domain 2-like 1.44e-43 GHMP Kinase, N-terminal domain 0.00000155 1fi4 A:3-190 Alignments

Protein Sequence Details

Sequence length 416
Comment
Sequence
MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNGKEISLSGGRYQNCLREIRARACAVEDKEKGIKIAKKDWEKLHLHVASYNNFPTAAGLASSAAGFACLVFALAKLMNAKEDNSELSAIARQGSGSACRSLFGGFVKWIMGKAEDGSDSLAVQLVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKRIKQMEEAIKNRDFGSFAQLSCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNCSEGTPQVAYTFDAGPNAVLIAHNRKAATQLMQKLLFCFPPSSDADLNSYVIGDKSILKDAGIEDIKDVEALPPPPEIKDAQRCKGDVSYFICTKPGRGPALLSDESQALLHPETGLPK

Download

Sequence (FASTA)