Domain assignment for POPTR_0001s35530.1|PACid:18234536 from Populus trichocarpa v156

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 195 Ribosomal protein S5 domain 2-like 7.51e-24 GHMP Kinase, N-terminal domain 0.0037 1kkh A:1-180 Alignments
203 345 GHMP Kinase, C-terminal domain 5.76e-18 Mevalonate kinase 0.025 1kkh A:181-317 Alignments

Protein Sequence Details

Sequence length 361
Comment
Sequence
MDEESPSSRKSNEIEHKVYARVGLLGNPSDVYYGRTISFSLANFWATVKLQPSHHLIITPHPTHDLVQFSGLDHLVNRLQSEGYYGGVRLLMSICKVFYNYCNENNIELSRENFTLSYDTNIPRQTGLSGSSAIVCAALNCLLDFYKVRHLVKVEIRPDLILSAEKELGIIAGLQDRVAQVYGGLVYMDFNKDHMEKLGHGVYTPMDTSLLPPLQLIYAENPSDSGKVHSTVQKRWLDGDEFIVSSMAEVADLALQGQTAILEKDYSKLADLMNRNFDLRRSMFGDDALGSLNIEMVEVARRVGAASKFTGSGGAVVVFCPDGPPQVKLLEDACKEAGFVIQPVKVVPSYLNEDDLKTLPG

Download

Sequence (FASTA)