Domain assignment for jgi|Ostta4|18209|e_gw1.07.00.151.1 from Ostreococcus tauri

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
22 414 Nucleotide-diphospho-sugar transferases 9.86e-77 glucose-1-phosphate thymidylyltransferase 0.00000000613 1yp2 A:10-316 Alignments
317 453 Trimeric LpxA-like enzymes 4.57e-24 GlmU C-terminal domain-like 0.0000347 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 453
Comment
Sequence
MAGTNTPVTAALGAAAANDGMDNVLSIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCINSDINKVYCLTQFNSASLNRHLAQAYNTNIGTHTRQGFVEVLAAQQSPVNKAWFQGTADAVRQYLWLFEESKCEEYLILSGDHLYRMDYRPFIMKHRETEAAITVAALPCDEKRASSFGLMKIDNTGRVIEFAEKPKGAELQAMKVDTTVLGLDADKAQEMPFIASMGIYVFDAKKMRECLLENFKEADDFGGEIIPMAAQMGLKVQAFLYEGYWEDIGTVDAFFHANLSCNDPNPAFNFHEMNAPIYTQSRFLPPSKVQDCEIERSTIGDGCFITKAKLKNVMVGLRSTVNANCDLEDTLVMGADYYETYDEAKTSALPGGVPIGIGAGTKIRKAIIDKNARIGENCQILNEAGVMDKDCENEGYIIRDGIIVVIKDAVIKPGTVI

Download

Sequence (FASTA)