Domain assignment for gi|383782700|ref|YP_005467267.1| from Actinoplanes missouriensis 431

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
13 292 Nucleotide-diphospho-sugar transferases 4.96e-61 glucose-1-phosphate thymidylyltransferase 0.0058 1fxo A: Alignments

Protein Sequence Details

Sequence length 303
Comment putative UTP-glucose-1-phosphate uridylyltransferase [Actinoplanes missouriensis 431]
Sequence
MTTNAQGTGRRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEAAAAGITDVLLVTGRGKTSMVDHFDRRPDVEQRLADKGDTARLEAVRRTSELADIYTVRQGEPLGLGHAVGTAASHVGPDNAFAVLLGDEFVEESRPLLPQMLDLQAETGGIVLALMEVDPSETSRYGIASVEKSDEEDIVRITGLVEKPKPEESPSNLAVLGRYVLPGKIFETIADTKPGAGGEIQLTDAMATLLAEGTPVHGIVYRGHRYDTGMPLGYLQAVVQLAVQRPDLGEEFRAWLTDFVGGQKG

Download

Sequence (FASTA)