Domain assignment for gi|383780241|ref|YP_005464807.1| from Actinoplanes missouriensis 431

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 283 Nucleotide-diphospho-sugar transferases 3.96e-81 glucose-1-phosphate thymidylyltransferase 0.000000049 1fxo A: Alignments

Protein Sequence Details

Sequence length 296
Comment putative glucose-1-phosphate thymidylyltransferase [Actinoplanes missouriensis 431]
Sequence
MKGIVLAGGTGSRLHPVTIGICKQLAPVYNKPMIYYPLSTLMLAGITDILIICTPADRPAFTRLLGDGSRLGLTLTYAEQPQPNGLAEAFLIGASHIGDDTVALVLGDNIFHGHGFSGLLQSLAADVKGAVLFGYEVADPHRHGIGETDAGGRLVSIEEKPEHPRSNRAITGLYFYDNDVVEIAGRVTPSARGELEITDVSRAYMERGQARVVDLGRGFAWLDTGTHASLLDAGQYVRTLEERQGIQIACLEEIAMRMGLITPEQCYRLGAGAGHSTYSQYVMDTARAAMAGHRPE

Download

Sequence (FASTA)