Domain assignment for gi|383777605|ref|YP_005462171.1| from Actinoplanes missouriensis 431

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 285 Nucleotide-diphospho-sugar transferases 1.08e-85 glucose-1-phosphate thymidylyltransferase 0.0000000309 1h5r A: Alignments

Protein Sequence Details

Sequence length 294
Comment putative glucose-1-phosphate thymidyltransferase [Actinoplanes missouriensis 431]
Sequence
MRGILLAGGTGSRLWPITKAMSKQLMPIFDKPMIYYPLTTLVSAGIREILVITTPEDQPHFERLLGDGKQFGLSLTYAQQPKPDGIAQAFRIGADFIGDEPVALILGDNIFHGVGLGRQLARFGEPAGGRVFAYPVADPERYGVVEFDESGKVLSIEEKPERPKSTYVVPGLYFYDADVVEIAGDLKPSARGELEITAVNEEYLRQGRLDVTVLDRGTVWLDTGTFQSMVQASEYVRVIEERQGLKIGCVEEAAWRLGFISDDQLRELAEPLLKSGYGEYLVRLLSAGRFGGVL

Download

Sequence (FASTA)