Domain assignment for gi|218697115|ref|YP_002404782.1| from Escherichia coli 55989

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
20 393 Nucleotide-diphospho-sugar transferases 5.51e-78 glucose-1-phosphate thymidylyltransferase 0.00000963 1yp2 A:10-316 Alignments
313 411 Trimeric LpxA-like enzymes 5.68e-18 GlmU C-terminal domain-like 0.032 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 431
Comment glucose-1-phosphate adenylyltransferase [Escherichia coli 55989]
Sequence
MVSLEKNDHLMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQER

Download

Sequence (FASTA)