Domain assignment for gi|387627164|ref|YP_006063340.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
150 313 Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.73e-66 GAPDH-like 0.00000157 1hdg O:149-312 Alignments
3 167 NAD(P)-binding Rossmann-fold domains 7.58e-59 Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000182 1gad O:0-148,O:313-330 Alignments

Protein Sequence Details

Sequence length 335
Comment glyceraldehyde-3-phosphate dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPVMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGKFIKVSAERDPEQIDWATDGVEIVLEATGFFAKKEAAEKHLKGGAKKVVITAPGGNDVKTVVFNTNHDVLDGTETVISGASCTTNCLAPMAKALQDNFGVVEGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPTPTGSVTELVAVLEKNVTVDEVNAAMKAASNESYGYTEDPIVSSDIVGMSYGSLFDATQTKVLDVDGKQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK

Download

Sequence (FASTA)