Domain assignment for gi|387627033|ref|YP_006063209.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 179 GroES-like 2.99e-40 Alcohol dehydrogenase-like, N-terminal domain 0.00067 1rjw A:1-137,A:306-339 Alignments
148 309 NAD(P)-binding Rossmann-fold domains 2.03e-33 Alcohol dehydrogenase-like, C-terminal domain 0.0044 1f8f A:163-336 Alignments

Protein Sequence Details

Sequence length 345
Comment zinc-binding dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MKSAVYTKAGQVGLASIERPQIIEVDDVIIRVVRACVCGSDLWRYRNPETKAGHKNSGHEAIGIVEEAGEAITTVKPGDFVIVPFTHGCGECDACLAGFDGSCDNHIGNNLGGDFQAEYIRFHYANWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAVGQCAVIAAKMRGASQIILMSRHEDRQKMAMESGATVVVAERGQEGITKVREILGGGADAALECVGTEAAIEQALGVLHNGGRMGFVGVPHYNNRALGSTFMQNISVAGGAASATTYDKQFLLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKSMIVIE

Download

Sequence (FASTA)