Domain assignment for gi|387627031|ref|YP_006063207.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	6	207	Ribosomal protein S5 domain 2-like	4.17e-61	GHMP Kinase, N-terminal domain	0.000000831	1pie A:9-213	Alignments
	210	390	GHMP Kinase, C-terminal domain	3.45e-56	Galactokinase	0.00000391	1pie A:214-396	Alignments

Protein Sequence Details

Sequence length	392
Comment	galactokinase [Streptococcus pneumoniae INV104]
Sequence	MAQHLTTEALRKDFLAVFGQEADQTFFSPGRINLIGEHTDYNGGHVFPAAISLGTYGAARKRDDQVLRFYSANFEDKGIIEVPLADLKFEKEHNWTNYPKGVLHFLQEAGHVIDKGFDFYVYGNIPNGAGLSSSASLELLTGVVAEHLFDLKLERLDLVKIGKQTENNFIGVNSGIMDQFAIGMGADQRAIYLDTNTLEYDLVPLDLKDNVVVIMNTNKRRELADSKYNERRAECEKAVEELQVALDIQTLGELDEWAVDQYSYLIKDENRLKRARHAVFENQRTLKAQAALQAGDLETFGRLMNASHVSLEHDYEVTGLELDTLVHTAWAQEGVLGARMTGAGFGGCAIALVQKDTVEAFKEAVGKHYEEVVGYAPSFYIAEVAGGTRVLD

Download

Sequence (FASTA)

---