Domain assignment for gi|387626880|ref|YP_006063056.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 146 NAD(P)-binding Rossmann-fold domains 2.66e-47 Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0023 1ofg A:1-160,A:323-381 Alignments
126 256 Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.59e-25 Glucose 6-phosphate dehydrogenase-like 0.0039 1zh8 A:132-275 Alignments

Protein Sequence Details

Sequence length 367
Comment putative oxidoreductase [Streptococcus pneumoniae INV104]
Sequence
MVKYGVVGAGYFGAELARYMQKNDGAEITLLYDPDNAEAIAEELGAKVASSLDELVSSDEVDCVIVATPNNLHKEPVIKAAQHGKNVFCEKPIALSYQDCREMVDACKENNVTFMAGHIMNFFNGVHHAKELINQGVIGDVLYCHTARNGWEEQQPSVSWKKIREKSGGHLYHHIHELDCVQFLMGGMPETVTMTGGNVAHEGEHFGDEDDMIFVNMEFSNKRFALLEWGSAYRWGEHYVLIQGSKGAIRLDLFNCKGTLKLDGQESYFLIHESQEEDDDRTRIYHSTEMDGAIAYGKPGKRTPLWLSSVIDKEMRYLHEIMEGAPVSEEFAKLLTGEAALEAIATADACTQSMFEDRKVKLSEIVK

Download

Sequence (FASTA)