Domain assignment for gi|387626780|ref|YP_006062956.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
119 227 Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.61e-41 Dihydrodipicolinate reductase-like 0.0000228 1p9l A:106-214 Alignments
3 145 NAD(P)-binding Rossmann-fold domains 1.24e-37 Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0033 1p9l A:1-105,A:215-245 Alignments

Protein Sequence Details

Sequence length 255
Comment putative dihydrodipicolinate reductase [Streptococcus pneumoniae INV104]
Sequence
MSIRVIIAGFKGKMGQAACQMVLTDPDLDLVAVLDPFESESEWQGIPVFKDKADLAGFEADVWVDFTTPAVAYENTRFALENGFAPVVGTTGFTSEEIAELKEFSRAQDLGGLIAPNFALGAVLLMQFATQAAKYFPNVEIIELHHDKKKDAPSGTAIKTAELMAEVRESIQQGAADEEELIAGARGADFDDMRIHSVRLPGLVAHQEVIFGNQGEGLTLRHDSYDRISFMTGVNLGIKEVVKRHELVYGLEHLL

Download

Sequence (FASTA)