Domain assignment for gi|387626718|ref|YP_006062894.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 138 NAD(P)-binding Rossmann-fold domains 6.03e-36 Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0038 1ydw A:6-133,A:305-360 Alignments
149 289 Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 0.000000000000018 Glucose 6-phosphate dehydrogenase-like 0.01 1ofg A:161-322 Alignments

Protein Sequence Details

Sequence length 325
Comment putative oxidoreductase [Streptococcus pneumoniae INV104]
Sequence
MLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVTQPQEWFDLIQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGADFNYAKYSSKMPDLLAGQTPNVFSDRFAGGALMDLGIYPLYAAVRLFEKANDATYHAQQLDNSIDLNGDGILFYPDYQVHIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHMIQQPDLNLYKTWLYDAGSVHELLYTMRQTAGIRFEAEK

Download

Sequence (FASTA)