Domain assignment for gi|387626635|ref|YP_006062810.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 106 Aminoacid dehydrogenase-like, N-terminal domain 1.15e-33 Shikimate dehydrogenase-like 0.00015 1nvt A:1-110 Alignments
107 281 NAD(P)-binding Rossmann-fold domains 6.38e-33 Aminoacid dehydrogenase-like, C-terminal domain 0.00023 1npd A:107-287 Alignments

Protein Sequence Details

Sequence length 284
Comment shikimate 5-dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MKLDGYTRLAAVVANPIKHSISPFIHNRAFEATATNGAYVAWEIEASDLVETVANIRRYQMFGINLSMPYKEQVIPYLDELSDEARLIGAVNTVVNENGNLIGYNTDGKGFFKCLPSFTISGKKMTLLGAGGAAKSILAQAILDGVSQISVFVRSVSMEKTRPYLDKLQEQTGFKVDLCALEYVSELQARIAESDLLVNATSVGMDGQSSPVPENIVLPETLLVADIIYQPFETPFLKWARSQGNPAVNGLGMLLYQAAEAFQLWTGKKMPTEEIWQSLTEKYQ

Download

Sequence (FASTA)