Domain assignment for gi|387626561|ref|YP_006062736.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 174 GroES-like 1.11e-23 Alcohol dehydrogenase-like, N-terminal domain 0.006 1e3j A:4-142,A:313-351 Alignments
140 297 NAD(P)-binding Rossmann-fold domains 0.000000000234 Alcohol dehydrogenase-like, C-terminal domain 0.033 1e3j A:143-312 Alignments

Protein Sequence Details

Sequence length 340
Comment putative zinc-binding dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MINQIYQLTKPKFINVKYQEEAIDQENHILIRPNYMAVCHADQRYYQGKRDPKILNKKLPMAMIHESCGTVISDPTGTYEVGQKVVMIPNQSPMQSDEEFYENYMTGTHFLSSGFDGFMREFVSLPKDRVVAYDAIEDTVAAITEFVSVGMHAMNRLLTLAHSKRERIAVIGDGSLAFVVANIINYTLPEAEIVVIGRHWEKLELFSFAKECYITDNIPEELAFDHAFECCGGDGTGPAINDLIRYIRPQGTILMMGVSEYKVNLNTRDALEKGLILVGSSRSGRIDFKNAIQMMEVKKFANRLKNILYLEEPVREIKDIHRVFATDLNTAFKTVFKWEV

Download

Sequence (FASTA)