Domain assignment for gi|387626422|ref|YP_006062597.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
84 210 NAD(P)-binding Rossmann-fold domains 7.87e-24 Transcriptional repressor Rex, C-terminal domain 0.0019 1xcb A:78-203 Alignments
9 80 "Winged helix" DNA-binding domain 1.6e-20 Transcriptional repressor Rex, N-terminal domain 0.0043 1xcb A:4-77 Alignments

Protein Sequence Details

Sequence length 213
Comment putative redox-sensing transcriptional repressor [Streptococcus pneumoniae INV104]
Sequence
MKDKQFAIPKATAKRLSLYYRIFKRFHAEKIERANSKQIAEAIGIDSATVRRDFSYFGELGRRGFGYDVKKLMTFFADLLNDNSITNVMLVGIGNMGHALLHYRFHERNKMKIIMAFDLDDHPEVGTQTPDGIPIYGISQIKDKIKDADVKTAILTVPSVKSQEVANLLVDAGVKGILSFSPVHLHLPKDVVVQYVDLTSELQTLLYFMRKED

Download

Sequence (FASTA)