Domain assignment for gi|387626188|ref|YP_006062360.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
129 287 NAD(P)-binding Rossmann-fold domains 9.35e-54 Aminoacid dehydrogenase-like, C-terminal domain 0.0000149 1b0a A:123-288 Alignments
8 128 Aminoacid dehydrogenase-like, N-terminal domain 1.15e-40 Tetrahydrofolate dehydrogenase/cyclohydrolase 0.00013 1b0a A:2-122 Alignments

Protein Sequence Details

Sequence length 292
Comment bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [Streptococcus pneumoniae INV104]
Sequence
MKEKRSDMTQIIDGKALAAKLQGQLAEKTAKLKEETALVPGLVVILVGDNPASQVYVRNKERSALAAGSRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDLEGKNAVVIGRSNIVGKPMAQLLLAKNATVTLTHSRTHNLAKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK

Download

Sequence (FASTA)