Domain assignment for gi|387626167|ref|YP_006062339.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 231 NAD(P)-binding Rossmann-fold domains 4.82e-60 Tyrosine-dependent oxidoreductases 0.00026 1fmc A: Alignments

Protein Sequence Details

Sequence length 232
Comment putative short chain dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MTKRVLITGVSSGIGLAQARLFLEKGYQVYGVDQGEKPLLEGDFHFLQRDLTLDLEPIFDWCPQVDVLCNTAGVLDDYKPLLEQTAQDIQEIFEINYIIPVELTRYYLTQMLENKKGIIINMCSIASSLAGGGGHAYTSSKHALAGFTKQLALDYAEAGIQVFGIAPGAVKTAMTAADFEPGGLADWVASETPIKRWIEPEEIAELSLFLASGKASAMQGQILTIDGGWSLK

Download

Sequence (FASTA)