Domain assignment for gi|387625880|ref|YP_006062052.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 243 NAD(P)-binding Rossmann-fold domains 2.72e-80 Tyrosine-dependent oxidoreductases 0.00000141 1edo A: Alignments

Protein Sequence Details

Sequence length 243
Comment 3-oxoacyl-ACP reductase [Streptococcus pneumoniae INV104]
Sequence
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM

Download

Sequence (FASTA)