Domain assignment for gi|387625834|ref|YP_006062006.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 335 NAD(P)-binding Rossmann-fold domains 2.79e-91 Tyrosine-dependent oxidoreductases 0.0000000000162 1kep A: Alignments

Protein Sequence Details

Sequence length 349
Comment dTDP-D-glucose 4,6-dehydratase RmlB [Streptococcus pneumoniae INV104]
Sequence
MTEYKNIIVTGGAGFIGSNFVHYVYENFPDVHVTVLDKLTYAGNRANIEEILGNRVELVVGDIADAELVDKLVAQADAIVHYAAESHNDNSLNDPSPFIHTNFIGIYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETKYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILSGIKPKLYGEGKNVRDWIHTNDHSSGVWTILTKGQIGETYLIGADGEKNNKEVLELILKEMGQATDAYDHVTDRAGHDLRYAIDASKLRDELGWKPEFTNFEAGLKATIKWYTDNQEWWKAEKEAVEANYAKTQEIITV

Download

Sequence (FASTA)