Domain assignment for gi|387625791|ref|YP_006061963.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 264 NAD(P)-binding Rossmann-fold domains 1.02e-79 Tyrosine-dependent oxidoreductases 0.0000176 1fmc A: Alignments

Protein Sequence Details

Sequence length 271
Comment putative gluconate 5-dehydrogenase [Streptococcus pneumoniae INV104]
Sequence
MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVFNDINQDLVNKGIEAYREVGIEAHGYVCDVTDEDGIQAMVKQIEQEVGVIDILVNNAGIIRRVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFDQFIIAKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE

Download

Sequence (FASTA)