Domain assignment for gi|387625566|ref|YP_006061738.1| from Streptococcus pneumoniae INV104

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 141 NAD(P)-binding Rossmann-fold domains 1.04e-37 CoA-binding domain 0.00039 1iuk A: Alignments

Protein Sequence Details

Sequence length 145
Comment putative CoA-binding protein [Streptococcus pneumoniae INV104]
Sequence
MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQARGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVYRRSEFLPDVARDFLKADAKIFWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA

Download

Sequence (FASTA)