Domain assignment for gi|308069280|ref|YP_003870885.1| from Paenibacillus polymyxa E681

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 342 Nucleotide-diphospho-sugar transferases 3.18e-84 glucose-1-phosphate thymidylyltransferase 0.0000308 1yp2 A:10-316 Alignments
297 381 Trimeric LpxA-like enzymes 0.0000000000000283 YdcK-like 0.081 2f9c A:3-322 Alignments

Protein Sequence Details

Sequence length 408
Comment glucose-1-phosphate adenylyltransferase [Paenibacillus polymyxa E681]
Sequence
MFNKECIAMLLAGGEGRRLAPLTSTIAKPAVPFGGHYRIIDFPLSNCVNSDIDTVGVLTQYEAESLHEHIGDGTPWGLTKTDDKGITLLPSYNTGNTEYLGTADAIHKNIEYIDSQNPEHVLILSGDHIYYMNYREMLNHHKEKGAAATISVMEVPWDEAHRFGVMSADEDLRVTEFAEKPEKPESNLASMGIYLFKWDYLRNYLLEDAQDAQSSHDFGKDIIPKMLADQESLYVYEFQGYWKDVGTVKSLWDSHMDLLHEDCAIDLQRKDWPMYTRERRTRLSAQKVPNRQTQPLGSLLHDSCQVEGRIERSVVFSGVEVGKGSTIKESIVMPDTRIGRNVHIEHAIIGEGAVIRDGAVIKGNPGEIMVIGPNETVFGKMALRPQTTRMLKEAYERNIRLRAEGFTS

Download

Sequence (FASTA)