Domain assignment for gi|308068831|ref|YP_003870436.1| from Paenibacillus polymyxa E681

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
17 332 Nucleotide-diphospho-sugar transferases 5.95e-45 glucose-1-phosphate thymidylyltransferase 0.001 1yp2 A:10-316 Alignments
281 356 Trimeric LpxA-like enzymes 0.0000000000633 GlmU C-terminal domain-like 0.023 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 367
Comment glycogen biosynthesis protein GlgD [Paenibacillus polymyxa E681]
Sequence
MSRLIGVINLDHELDQLKELTYFRCGAAVPFASRYRLIDFTLSNMMHAGVHDIALFIRRKYRSLLDHLGEGRPWDLDRRRGGLFILPPDWNDPTDASRGDLQHVHNNLDFFHRSSGQTIIHAGTQHVNKVDIEDVYRYHREKNADVTLVYKPIDQLESEHAPCARLEIDENGRVTGIHQEQDHHNIYLEMFVMDKGLYLDQVKHCIAHQDNHFFRDAIQKNPSGLRIYAYRYEGYHAVINSIESYYKNSMKLLDQQQYQALFQNQPVHTKIKYEAPTRYTPSAEVDHSLVANGCTIGGKVENSILFRGVQVEEGARVSNSIIMQKCVIRKGAVVENVVLDKDVQLSPDRTLIGDIRVPYVIAKNSVI

Download

Sequence (FASTA)