Domain assignment for gi|308068830|ref|YP_003870435.1| from Paenibacillus polymyxa E681

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 340 Nucleotide-diphospho-sugar transferases 1.56e-82 glucose-1-phosphate thymidylyltransferase 0.000033 1yp2 A:10-316 Alignments
290 361 Trimeric LpxA-like enzymes 4.54e-17 GlmU C-terminal domain-like 0.016 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 381
Comment glucose-1-phosphate adenylyltransferase [Paenibacillus polymyxa E681]
Sequence
MRKKEVVAMLLAGGQGKRLKGLTRTLAKPAVFFGGTYRIIDFPLSNCTHSGIDTVGVLTQYEPLVLHSYIGVGSDWDLDRLDGGVFVLPPHEKEDGNNWYRGTADAIYRNLHFLDQYDPEHVLILSGDHIYKMDYSRMLHYHKEKEADCTISVINVTIQEAKRFGILNADDDLKIYDFEEKPEQPKSTLASMGIYLFKWEVLRRYLLESASDSESSHDFGKDIIPLLLQHGRSLYAYPFAGYWKDVGTIQSLWESNMDLLVQDPPLDLNDPFWRIYTRSPNQPAQYITQRAILKNSIVNEGCMVDGEVRHSVLFYGVEVGEGSVITDSVIMPNVKIGRNVRIHRAIVNENMVIEDNAVIGPENSSDEIILFDQESQLHARI

Download

Sequence (FASTA)