Domain assignment for gi|209809347|ref|YP_002264885.1| from Aliivibrio salmonicida LFI1238

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 70 NE0471 N-terminal domain-like 0.000000000641 NE0471 N-terminal domain-like 0.0098 2auw A:4-87 Alignments

Protein Sequence Details

Sequence length 174
Comment hypothetical protein VSAL_II0559 [Aliivibrio salmonicida LFI1238]
Sequence
MLKVIDVDLVANFTLELTFSDGYTGEANLTEYFQKEAFSHVANFQKFALTADGSLDWSGAELSAATLKEITVGSYTESDLTPFDVKEMEMVIKQASWDSMQEGRADILQAAIRSYVEQFGHSVVIERAGIKSRTSAYRSLKPETTPSFGTLVQLGHAVIELAKDRVSAHSLSRM

Download

Sequence (FASTA)