Domain assignment for gi|319760479|ref|YP_004124417.1| from Candidatus Blochmannia vafer str. BVAF

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 159 Ribosomal protein S5 domain 2-like 2.96e-38 GHMP Kinase, N-terminal domain 0.00000665 1oj4 A:1-163 Alignments
163 281 GHMP Kinase, C-terminal domain 2.69e-26 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.00025 1oj4 A:164-283 Alignments

Protein Sequence Details

Sequence length 287
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Candidatus Blochmannia vafer str. BVAF]
Sequence
MHQWVVSPGKLNLFLYVTGRRSDGYHYLQTLFRLLDYGDNMKFFVTKNGCIRLFNTNNNIISNNNLVIQAAKLLRKFCFRSCQKKPGVDIILHKKLPIGSGLGGGSSNAATTLMILNQEWRCFLEKKVLMRLGLMLGADIPVFINGYSAFSEGIGEKLVSIFLPERWYLIIIPPIYINTTWVFDVYRSAFNYYSPYRSVEKLLNTPFSNDLEPIVKNMFPEIKKYFFYLSNYASARLTGTGACIFFEFYNRYLACQSQKYLPNWIKSIVVRGIYISPVHQILSKIKI

Download

Sequence (FASTA)