Domain assignment for jgi|Phybl1|40678|estExt_Genewise1Plus.C_240033 from Phycomyces blakesleeanus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 334 Nucleotide-diphospho-sugar transferases 9.91e-53 glucose-1-phosphate thymidylyltransferase 0.057 1h5r A: Alignments
232 400 Trimeric LpxA-like enzymes 1.44e-23 GlmU C-terminal domain-like 0.053 1hm9 A:252-459 Alignments

Protein Sequence Details

Sequence length 413
Comment
Sequence
MSQYKAIILVGGPSRATRFRPLSLDVPKPLFPVAGAPIISHHLAALSKVEGLQEVLIIGFFEDSVFTRFLEDAANEYPHINIRYLREYQSLGTAGGLFHFRDEILRGNPQQFFVMHVDIACSFPLNEMMAAHMKHRGLCTMLSTKVPRDQATKYGCLVAKPDTNEVLHYVEKPETFISDLISCGVYLFDTAVFGEMRKAIERKKDVHHEESDYLWTSSDDRLRLEQDLLRPLSESRKLYVYVTENFWRQIKTASSAIPANAAYLEQCARENPSRLAHNKPDGPEIIGAVYIHPSAQVDPTAKIGPNVSIGSRVHIGKGVRIKDSIILDNVQIGNAGCVLHSVIGWNSKIGAWARVEGTPISDHNTSMMSNGVKSQSITILGKEVSVMDETIIRNCIVLPHKELKSSFHSEILM

Download

Sequence (FASTA)