Domain assignment for gi|68249414|ref|YP_248526.1| from Haemophilus influenzae 86-028NP

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 216 Ribosomal protein S5 domain 2-like 2.73e-62 GHMP Kinase, N-terminal domain 0.0000203 1wuu A:2-216 Alignments
218 398 GHMP Kinase, C-terminal domain 1.42e-51 Galactokinase 0.00013 1wuu A:217-392 Alignments

Protein Sequence Details

Sequence length 398
Comment galactokinase [Haemophilus influenzae 86-028NP]
Sequence
MVQIEYRFNIKDRNMTPIQNAQQIFNRQHKNLPEITVYAPGRVNIIGEHTDYNDGFVMPCAINFGTAVSGTKRDDHIWNVYAADLDETDEFSLNVEIPKSEHKWANYVRGVVKFIQERYPHFQQGANLVISGNVPLSSGLSSSAALEVAVGKFCQQLGDLPLSHTDIALNGQKAENQFVGANCGNMDQLISALGQENHLLMIDCRSLETIPTPVPQDVAVIIVNSNVPHDLVTGEYNTRRQQCEEAVKFFGAKALRDVSVEQFQKREAELTALSPLAAKRARHVVTENQRVLDAVEALKNNDLTCLGKLMEASHDSMRDDFEITVPQIDYLVELAQLVIGKSGGARMTGGGFGGCIVALTPHDKVDAVRKIIADNYEKTTGLKETFYVCTASQGVRVI

Download

Sequence (FASTA)