Domain assignment for gi|296505689|ref|YP_003667389.1| from Bacillus thuringiensis BMB171

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
114 236 Trimeric LpxA-like enzymes 2.08e-35 Galactoside acetyltransferase-like 0.032 1kk6 A: Alignments

Protein Sequence Details

Sequence length 238
Comment dTDP-glucose 4,6-dehydratase [Bacillus thuringiensis BMB171]
Sequence
MISLLNFLISKLKKTEYKLDSSITTTNILGIVSSRTISLWRGFFKRIGLKKCGKVLFIGRRVILKNKNAIELGNGVTLDNYVSLDGLSKEGLKVGNNVKVGSYTIIACSGSLKHLGKGMTIGDNSGIGDFSFFGAAGGIRIGKNVIMGQNVRFHSENHNFDRLDIPIKEQGVTNKGIIVGDDCWIGSGAVFLDGVKVGEGSVIGANTLVNKDIPPFSVAVGNPVKIVKNRMKNEERTN

Download

Sequence (FASTA)