Domain assignment for gi|296505332|ref|YP_003667032.1| from Bacillus thuringiensis BMB171

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 301 Nucleotide-diphospho-sugar transferases 3.94e-36 glucose-1-phosphate thymidylyltransferase 0.005 1yp2 A:10-316 Alignments
253 325 Trimeric LpxA-like enzymes 0.00000000000000177 GlmU C-terminal domain-like 0.024 1yp2 A:317-451 Alignments

Protein Sequence Details

Sequence length 344
Comment glucose-1-phosphate adenylyltransferase [Bacillus thuringiensis BMB171]
Sequence
MGEKMLGIINATGSFPSLKKVTGHRSLAALPFGGRYRLIDFMLSNMVNSSIHSVAVFTSHKNRSLMDHVGSGKQWDLDRKRDGLFLFPPNCQCDQDEFGSFAHFRRHIDYFLRSREEYVVITNSHLVTALNFQAVLERHIHTAADITEVCHEGVSLQTYVLKKQLLLDLFESYKGVEQYSLFDVVREKRGKSLHIATYEHTGYVAIIDSIESYYKHSLEILQPAIWKQLFKKEAPIFTKVKDEPPTRYLKGAVVKNTMIANGSIIEGEVENSVVSRSVKIGKGSIIRNSIIMQKSQIGDNCIIDGVIIDKDVKIGDGVVLKGSADEPYVVEKGSVQNSTINSYS

Download

Sequence (FASTA)