Domain assignment for gi|296505224|ref|YP_003666924.1| from Bacillus thuringiensis BMB171

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 168 Trimeric LpxA-like enzymes 2.91e-51 gamma-carbonic anhydrase-like 0.0000000918 1xhd A: Alignments

Protein Sequence Details

Sequence length 170
Comment acetyltransferase/acyltransferase [Bacillus thuringiensis BMB171]
Sequence
MIYPYKEKKPKIASSAFIADYVTITGDVYIGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQYPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYKSLQK

Download

Sequence (FASTA)