Domain assignment for gi|296502568|ref|YP_003664268.1| from Bacillus thuringiensis BMB171

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
18 178 Trimeric LpxA-like enzymes 8.77e-30 gamma-carbonic anhydrase-like 0.053 1v3w A: Alignments

Protein Sequence Details

Sequence length 188
Comment galactoside O-acetyltransferase [Bacillus thuringiensis BMB171]
Sequence
MNSFYSQEELKQIGFLSVGKNVLVSKKASIYNPSAISVGNHVRIDDFCILSGKITIGSYSHISAYTALYGGEVGIEMHDFANISAKTIVYAVLDDFSGNTLMGPTVPNQYRNVKAEKVILKKHVIIGANSIIFPNVIVGEGAAVGAMSMVKESLDDWYIYAGIPVRKVKPRQKKMLELEIDFLKSIHS

Download

Sequence (FASTA)