Domain assignment for gi|302348587|ref|YP_003816225.1| from Acidilobus saccharovorans 345-15

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
12 190 Ribosomal protein S5 domain 2-like 8.35e-50 GHMP Kinase, N-terminal domain 0.00000359 1s4e A:5-180 Alignments
192 360 GHMP Kinase, C-terminal domain 2.7e-40 Galactokinase 0.0000224 1s4e A:181-351 Alignments

Protein Sequence Details

Sequence length 367
Comment Galactokinase [Acidilobus saccharovorans 345-15]
Sequence
MGRPQGPRRLNMITVRSPGRVNIIGEHTDYALGYVMPMAIQLGTTFTAEPSLDERTCIFSEAMKEELCFGDELVREGRWIDYVKGVYYAIRSRGLRYMHVSGRLSGDLPMSSGLSSSASLEMAIAVAQNELARLGLSRLELARLGVTAENEFLGIPSGILDQFAAVMGKEGKAVFTDTETLNYEYVPIPEDVEFLVFHTGIRRAVAGTEYSERVKVVKSALRALGVSSSKYVREEQLSRLDELQRKRLGYVIRENSRVLAVRDALRSGDVVTTGRILTEAHWDLARNYEVSVPELDFFVEFATSHGAYGARLTGAGFGGAAIALVDRGKGEQLGREAEEEYVRRFPHRPQHWVVTPAEGARVIDVRP

Download

Sequence (FASTA)