Domain assignment for gi|389866307|ref|YP_006368548.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
21 304 Nucleotide-diphospho-sugar transferases 2.12e-82 glucose-1-phosphate thymidylyltransferase 0.0000000332 1mc3 A: Alignments

Protein Sequence Details

Sequence length 306
Comment glucose-1-phosphate thymidylyltransferase [Modestobacter marinus]
Sequence
MSGAAPAGRTPAVTAYGHRVRGIILAGGTGSRLWPITLGVSKQLMPVYDKPMIYYPLSTLMMAGIREVLVITTPEDRDSFARLLGDGSRLGMRIEYAVQPKPEGLAQAFLIGADFLAGQAAALVLGDNIFYGAGLGTALARLPEPEGGHVFAYHVANPTDYGVVEFDAAGRVLSIEEKPVTPKSSYAVPGLYFFGRDIVDVASTITPSARGELEITAVNEHYLRAGRLTVTVLDRGTAWLDTGTFASLRQATEFVSVVEERQGLKIGCIEEVAWRNGWLDDDGLRAIAEPLGKSGYGAYLLGLLAG

Download

Sequence (FASTA)