Domain assignment for gi|389865961|ref|YP_006368202.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
9 273 Thymidylate synthase/dCMP hydroxymethylase 1.96e-116 Thymidylate synthase/dCMP hydroxymethylase 0.0000000131 1qqq A: Alignments

Protein Sequence Details

Sequence length 273
Comment thymidylate synthase (TS) (TSase) [Modestobacter marinus]
Sequence
MPEVAVQQQVDTQYEDLLRRVLETGSPKSDRTGTGTLSLFGERLRYDLSAAFPLVTTKSVHFRSIAYELLWFLRGEGNVGWLREHGVTIWDEWAAEDGSLGPVYGVQWRSWPTPDGGSIDQLAGILDTLRRDPDSRRMVVSAWNVAALPEMALAPCHALFQFHVADGRLSCQLYQRSADLFLGVPFNIASYALLTQMVAQQVGLEPGDFIWVGGDCHIYTNHLPQVREQLSREVLPFPQLTIDPAPSLFEHDYADLHLVDYRHHPGIRGAVAV

Download

Sequence (FASTA)