Domain assignment for gi|389865961|ref|YP_006368202.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	9	273	Thymidylate synthase/dCMP hydroxymethylase	1.96e-116	Thymidylate synthase/dCMP hydroxymethylase	0.0000000131	1qqq A:	Alignments

Protein Sequence Details

Sequence length	273
Comment	thymidylate synthase (TS) (TSase) [Modestobacter marinus]
Sequence	MPEVAVQQQVDTQYEDLLRRVLETGSPKSDRTGTGTLSLFGERLRYDLSAAFPLVTTKSVHFRSIAYELLWFLRGEGNVGWLREHGVTIWDEWAAEDGSLGPVYGVQWRSWPTPDGGSIDQLAGILDTLRRDPDSRRMVVSAWNVAALPEMALAPCHALFQFHVADGRLSCQLYQRSADLFLGVPFNIASYALLTQMVAQQVGLEPGDFIWVGGDCHIYTNHLPQVREQLSREVLPFPQLTIDPAPSLFEHDYADLHLVDYRHHPGIRGAVAV

Download

Sequence (FASTA)

---