Domain assignment for gi|389865545|ref|YP_006367786.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
13 347 UROD/MetE-like 6.02e-102 Uroporphyrinogen decarboxylase, UROD 0.000000651 1j93 A: Alignments

Protein Sequence Details

Sequence length 348
Comment uroporphyrinogen decarboxylase [Modestobacter marinus]
Sequence
MGTAAGPAADSALVRAARGLPVDRTPVWFMRQAGRSLPEYRALRAGTAMLQACQDPDLVTEITLQPVRRHGVDAAILFSDIVLPLVVAGMDIEIKPGVGPVVASPVRSVADVDALPPLEPDRLEFLATSVRRLVAELGSTPLIGFAGAPFTLATYLIEGGPSKEHARTKAFMYAEPEAWRRLLERLAVSAATFLQVQVDAGASAVQLFDSWAGVLSATDYASRVLPHSRAVFDALGDRDVPKVHFGVGTGELLPLIGDAGADVVGVDWRVPLDEAARRVGPGYSLQGNLDPAVLLADRETVDREVRRVVEQGRAARGHVFNLGHGVLPDTDPGVLTHVVELVHELSAR

Download

Sequence (FASTA)