Domain assignment for gi|389864982|ref|YP_006367223.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 139 Type II 3-dehydroquinate dehydratase 2.75e-54 Type II 3-dehydroquinate dehydratase 0.00000388 2dhq A: Alignments

Protein Sequence Details

Sequence length 144
Comment 3-dehydroquinate dehydratase type 2 [Modestobacter marinus]
Sequence
MTIQVLNGANLGRLGTREPEVYGTTTYAELVELLQAAARELDVAVQVRQTDDEGQLLRWVHEATDAGDPVVVNPGGWSHTSVVLHDALAAVTAPVVEVHISNIAAREPFRHHSYVSPAATGVITGLGVHGYVLALQWLVLKGVR

Download

Sequence (FASTA)