Domain assignment for gi|389864982|ref|YP_006367223.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

	Start Residue	End Residue	Superfamily	Superfamily E-value	Family	Family E-value	Closest structure	View
	1	139	Type II 3-dehydroquinate dehydratase	2.75e-54	Type II 3-dehydroquinate dehydratase	0.00000388	2dhq A:	Alignments

Protein Sequence Details

Sequence length	144
Comment	3-dehydroquinate dehydratase type 2 [Modestobacter marinus]
Sequence	MTIQVLNGANLGRLGTREPEVYGTTTYAELVELLQAAARELDVAVQVRQTDDEGQLLRWVHEATDAGDPVVVNPGGWSHTSVVLHDALAAVTAPVVEVHISNIAAREPFRHHSYVSPAATGVITGLGVHGYVLALQWLVLKGVR

Download

Sequence (FASTA)

---