Domain assignment for gi|389864957|ref|YP_006367198.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 191 Formyltransferase 3.53e-51 Formyltransferase 0.00000719 1fmt A:1-206 Alignments
193 295 FMT C-terminal domain-like 8.32e-28 Post formyltransferase domain 0.00076 1fmt A:207-314 Alignments

Protein Sequence Details

Sequence length 301
Comment methionyl-tRNA formyltransferase [Modestobacter marinus]
Sequence
MVALDALLGSDHEVVAVLTRPDAPSGRGRRTSRSRVAERADVAGIPVLQPRSPREPEFLTTLGELAVDCAPVVAYGALVPPAALDLPRHGWVNLHFSLLPAWRGAAPVQHAVMAGDEVTGAATFQLEAGLDTGPVFGVVTEPIGPRDTAGDLLDRLAVSGAGLLVATLDGIADGSLRAEPQPAEGVSLAPRIETADARVDWTLPAHVVDRRVRGVTPAPGAWTTWRGNRLRLAPVEPLSSSLSLEPGELSVGVTGVLVGTGRGAVRLTEVQPAGKRMLPAADWARGARPEPGERLGEQVGA

Download

Sequence (FASTA)