Domain assignment for gi|389864616|ref|YP_006366856.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 149 Type II 3-dehydroquinate dehydratase 1.31e-55 Type II 3-dehydroquinate dehydratase 0.00000884 1d0i A: Alignments

Protein Sequence Details

Sequence length 152
Comment 3-dehydroquinate dehydratase [Modestobacter marinus]
Sequence
MGGPERPRVLVLNGPNLNMLGTREPAVYGTQTLRDVEALVTGRAQELGLDVDCSQSNHEGVLIDTLHAARSTHAGLVLNAGGLTHTSVVLRDAVAASELPFVEVHITNVHAREPFRHTSLLSDLAQAVIVGAGVRGYVFGLEVLHDLLRPRP

Download

Sequence (FASTA)