Domain assignment for gi|389864315|ref|YP_006366555.1| from Modestobacter marinus

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
13 248 PLC-like phosphodiesterases 1.91e-58 Glycerophosphoryl diester phosphodiesterase 0.00061 1vd6 A:8-224 Alignments

Protein Sequence Details

Sequence length 258
Comment glycerophosphoryl diester phosphodiesterase [Modestobacter marinus]
Sequence
MAGSRYAFLDGPTPVAMAHRGGAIEHLENTLPAFQECVDLGYRYLETDVRVTADGELVVFHDPTLDRVTDRTGRVDALPWREVQTALIGGREPILRLEDLLGAWPDIRFNLDIKAAGVLAPLVRSIRRLKAEHRVCLASFSDARVAAARRLFGPEVCTSLGPRGVAALRLSSYSPRAAGLVRIQAGCAQVPLQLGGRPLVDERFIAAAHARSLQVHVWTVDTEAAATEMLDLGVDGVMTDRPAMLRDLLVARGEWHGA

Download

Sequence (FASTA)